You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295512 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant BGN. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 4E1-1G7 |
Tested applications | ELISA, IHC-P, IP, WB |
Reactivity | Human |
Isotype | IgG2a kappa |
Immunogen | BGN (AAH02416.1, 1 a.a. ~ 368 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK |
NCBI | AAH02416.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
BGN monoclonal antibody (M01), clone 4E1-1G7 Western Blot analysis of BGN expression in HepG2.
Detection limit for recombinant GST tagged BGN is 0.03 ng/ml as a capture antibody.
Detection limit for recombinant GST tagged BGN is 3 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to BGN on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. [antibody concentration 1 ~ 10 ug/ml].
Immunoprecipitation of BGN transfected lysate using anti-BGN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BGN MaxPab rabbit polyclonal antibody.
Western Blot analysis of BGN expression in transfected 293T cell line by BGN monoclonal antibody (M01), clone 4E1-1G7. Lane 1: BGN transfected lysate(41.7 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (66.22 KDa).