You have no items in your shopping cart.
Cart summary
Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His)
Catalog Number: orb1979550
| Catalog Number | orb1979550 |
|---|---|
| Category | Proteins |
| Description | Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals. Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 9.6 kDa and the accession number is P01495. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 9.6 kDa (predicted) |
| UniProt ID | P01495 |
| Protein Sequence | KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Centruroides noxius |
| Biological Activity | Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals. Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 9.6 kDa and the accession number is P01495. |
| Expression Region | 17-82 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
