You have no items in your shopping cart.
Cart summary
BDNF Protein, Rat, Recombinant (His)
Catalog Number: orb1976669
| Catalog Number | orb1976669 |
|---|---|
| Category | Proteins |
| Description | BDNF Protein, Rat, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 16.3 kDa and the accession number is P23363. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 16.3 kDa (predicted) |
| UniProt ID | P23363 |
| Protein Sequence | RRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTL |
| Expression System | E. coli |
| Biological Origin | Rat |
| Biological Activity | BDNF Protein, Rat, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 16.3 kDa and the accession number is P23363. |
| Expression Region | 136-243 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
