BCR monoclonal antibody (M01), clone 2E5

• Catalog Number: orb2295539
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BCR.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: BCR (NP_004318.3, 182 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: FHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQ
• Tested applications: ELISA, IF, PLA, WB
• Clone Number: 2E5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004318.3

Detection limit for recombinant GST tagged BCR is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to BCR on HeLa cell. [antibody concentration 10 ug/ml].

Proximity Ligation Analysis of protein-protein interactions between TP53 and BCR. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-BCR mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of BCR expression in transfected 293T cell line by BCR monoclonal antibody (M01), clone 2E5. Lane 1: BCR transfected lysate (Predicted MW: 121 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).