Bcr Antibody (Phospho-Tyr360)

• Catalog Number: orb2240593
• Category: Antibodies
• Description: Bcr Antibody (Phospho-Tyr360)
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, ICC, IF, IHC, IHC-P, WB
• Immunogen: The antiserum was produced against synthesized peptide derived from human Bcr around the phosphorylation site of Tyr360.
• Conjugation: Unconjugated
• MW: 142 kDa
• UniProt ID: P11274
• Protein Sequence: Synthetic peptide located within the following region: DCSSNENLTSSEEDFSSGQSSRVSPSPTTYRMFRDKSRSPSQNSQQSFDS
• Storage: -20°C
• Alternative names: ALL;BCR, RhoGEF and GTPase activating protein;BCR/
• Note: For research use only
• Application notes: Application Info: WB: 1:500~1:1000IHC: 1:50~1:100IF: 1:100~1:500ELISA: 1:40000
• Expiration Date: 12 months from date of receipt.