BCAS2 monoclonal antibody (M01), clone 1D10

• Catalog Number: orb2291594
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BCAS2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1D10
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: BCAS2 (NP_005863, 116 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: HQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
• NCBI: NP_005863
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BCAS2 monoclonal antibody (M01), clone 1D10 Western Blot analysis of BCAS2 expression in K-562.

Detection limit for recombinant GST tagged BCAS2 is approximately 1 ng/ml as a capture antibody.

Western Blot analysis of BCAS2 expression in transfected 293T cell line by BCAS2 monoclonal antibody (M01), clone 1D10. Lane 1: BCAS2 transfected lysate (26.1 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of BCAS2 over-expressed 293 cell line, cotransfected with BCAS2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with BCAS2 monoclonal antibody (M01), clone 1D10 (Cat # orb2291594). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (37.84 KDa).