BCAR3 Antibody

• Catalog Number: orb334579
• Category: Antibodies
• Description: BCAR3 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BCAR3 (791-825aa KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL), different from the related mouse sequence by five amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 92566 MW
• UniProt ID: O75815
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Breast cancer anti-estrogen resistance protein 3;N
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of BCAR3 using anti-BCAR3 antibody.Lane 1:HEPG2 cell.

IHC analysis of BCAR3 using anti-BCAR3 antibody. BCAR3 was detected in a paraffin-embedded section of mouse lymphaden tissue.

IHC analysis of BCAR3 using anti-BCAR3 antibody. BCAR3 was detected in a paraffin-embedded section of rat spleen tissue.

IHC analysis of BCAR3 using anti-BCAR3 antibody. BCAR3 was detected in a paraffin-embedded section of human tonsil tissue.