BATF monoclonal antibody (M03), clone 1G4

• Catalog Number: orb2291542
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BATF.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1G4
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG1 Kappa
• Immunogen: BATF (NP_006390, 34 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
• NCBI: NP_006390
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BATF monoclonal antibody (M03), clone 1G4 Western Blot analysis of BATF expression in Hela S3 NE.

BATF monoclonal antibody (M03), clone 1G4. Western Blot analysis of BATF expression in PC-12.

BATF monoclonal antibody (M03), clone 1G4. Western Blot analysis of BATF expression in Raw 264.7.

Detection limit for recombinant GST tagged BATF is approximately 0.03 ng/ml as a capture antibody.

Western Blot analysis of BATF expression in transfected 293T cell line by BATF monoclonal antibody (M03), clone 1G4. Lane 1: BATF transfected lysate(14.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.86 KDa).