You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291543 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant BATF. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 8A12 |
Tested applications | ELISA, IP, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG1 Kappa |
Immunogen | BATF (NP_006390, 34 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP |
NCBI | NP_006390 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
BATF monoclonal antibody (M01), clone 8A12 Western Blot analysis of BATF expression in Hela S3 NE.
BATF monoclonal antibody (M01), clone 8A12. Western Blot analysis of BATF expression in NIH/3T3.
BATF monoclonal antibody (M01), clone 8A12. Western Blot analysis of BATF expression in PC-12.
BATF monoclonal antibody (M01), clone 8A12. Western Blot analysis of BATF expression in Raw 264.7.
Detection limit for recombinant GST tagged BATF is approximately 1 ng/ml as a capture antibody.
Immunoprecipitation of BATF transfected lysate using anti-BATF monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BATF MaxPab rabbit polyclonal antibody.
Western Blot analysis of BATF expression in transfected 293T cell line by BATF monoclonal antibody (M01), clone 8A12. Lane 1: BATF transfected lysate(14.1 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (35.86 KDa).