You have no items in your shopping cart.
Cart summary
BAS1 Recombinant Protein (Mouse-ear cress)
Catalog Number: orb2052492
| Catalog Number | orb2052492 |
|---|---|
| Category | Proteins |
| Description | BAS1 Recombinant Protein (Mouse-ear cress) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 27.4 kDa |
| UniProt ID | Q96291 |
| Protein Sequence | KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI |
| Source | E.coli |
| NCBI | NP_187769 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | AT3G11630;T19F11.3;Thiol-specific antioxidant prot Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
BAS1 Recombinant Protein (Mouse-ear cress) [orb2052493]
Greater than 90% as determined by SDS-PAGE.
27.4 kDa
E.coli
1 mgBAS1 Recombinant Protein (Mouse-ear cress) [orb2052494]
Greater than 90% as determined by SDS-PAGE.
27.4 kDa
E.coli
100 μgBAS1 Recombinant Protein (Mouse-ear cress) [orb2052535]
Greater than 90% as determined by SDS-PAGE.
24.4 kDa
Yeast
20 μgBAS1 Recombinant Protein (Mouse-ear cress) [orb2052536]
Greater than 90% as determined by SDS-PAGE.
24.4 kDa
Yeast
100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
