You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2052492 |
---|---|
Category | Proteins |
Description | BAS1 Recombinant Protein (Mouse-ear cress) |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 27.4 kDa |
UniProt ID | Q96291 |
Protein Sequence | KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI |
Source | E.coli |
NCBI | NP_187769 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | AT3G11630;T19F11.3;Thiol-specific antioxidant prot Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
27.4 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
27.4 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
24.4 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
24.4 kDa | |
Yeast |
Filter by Rating