BANF1 monoclonal antibody (M07), clone M2

• Catalog Number: orb2291824
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant BANF1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: M2
• Tested applications: ELISA, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2a Kappa
• Immunogen: BANF1 (AAH05942, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
• NCBI: AAH05942
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BANF1 monoclonal antibody (M07), clone M2. Western Blot analysis of BANF1 expression in Jurkat.

BANF1 monoclonal antibody (M07), clone M2. Western Blot analysis of BANF1 expression in PC-12.

BANF1 monoclonal antibody (M07), clone M2. Western Blot analysis of BANF1 expression in Raw 264.7.

Detection limit for recombinant GST tagged BANF1 is approximately 10 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to BANF1 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (35.53 KDa).