You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604800 |
---|---|
Category | Proteins |
Description | Recombinant Shigella flexneri Glutaredoxin-4(grxD) |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE |
Protein Length | Full Length |
UniProt ID | P0AC72 |
MW | 28.9 kDa |
Application notes | Full Length |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Shigella flexneri |
Expression Region | 1-115aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Monothiol glutaredoxin (ydhD) (Grx4) |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Shigella flexnerigrxD.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Shigella flexnerigrxD.