BAAT monoclonal antibody (M02), clone 5B6

• Catalog Number: orb2295602
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BAAT.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5B6
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: BAAT (NP_001692, 258 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: NGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFETTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLL
• NCBI: NP_001692
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BAAT monoclonal antibody (M02), clone 5B6 Western Blot analysis of BAAT expression in HepG2.

Detection limit for recombinant GST tagged BAAT is approximately 0.3 ng/ml as a capture antibody.

Western Blot detection against Immunogen (36.52 KDa).