B2M purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2295609
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human B2M protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: B2M (NP_004039.1, 1 a.a. ~ 119 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
• NCBI: NP_004039.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

B2M MaxPab rabbit polyclonal antibody. Western Blot analysis of B2M expression in human placenta.

Western Blot analysis of B2M expression in transfected 293T cell line by B2M MaxPab polyclonal antibody. Lane 1: B2M transfected lysate(13.70 KDa). Lane 2: Non-transfected lysate.