B-RAF Antibody (Phospho-Ser602)

• Catalog Number: orb2240592
• Category: Antibodies
• Description: B-RAF Antibody (Phospho-Ser602)
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, IF, IHC, IHC-P, WB
• Immunogen: The antiserum was produced against synthesized peptide derived from human B-RAF around the phosphorylation site of Ser602.
• Conjugation: Unconjugated
• MW: 84 kDa
• UniProt ID: P15056
• Protein Sequence: Synthetic peptide located within the following region: DLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVI
• Storage: -20°C
• Alternative names: 94 kDa B-raf protein;B-raf;B-Raf proto-oncogene se
• Note: For research use only
• Application notes: Application Info: WB: 1:500~1:1000IHC: 1:50~1:100ELISA: 1:20000
• Expiration Date: 12 months from date of receipt.