AXL monoclonal antibody (M01), clone 6C8

• Catalog Number: orb2295616
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant AXL.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6C8
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: AXL (AAH32229, 30 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPY
• NCBI: AAH32229
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AXL monoclonal antibody (M01), clone 6C8 Western Blot analysis of AXL expression in HeLa.

Detection limit for recombinant GST tagged AXL is approximately 0.3 ng/ml as a capture antibody.

Western Blot analysis of AXL expression in transfected 293T cell line by AXL monoclonal antibody (M01), clone 6C8. Lane 1: AXL transfected lysate(98 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of AXL over-expressed 293 cell line, cotransfected with AXL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with AXL monoclonal antibody (M01) clone 6C8 (Cat # orb2295616). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (37.84 KDa).