AVPR1A monoclonal antibody (M07), clone 7B8

• Catalog Number: orb2295623
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant AVPR1A.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 7B8
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: AVPR1A (NP_000697, 1 a.a. ~ 52 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAK
• NCBI: NP_000697
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of AVPR1A expression in transfected 293T cell line by AVPR1A monoclonal antibody (M07), clone 7B8. Lane 1: AVPR1A transfected lysate(46.8 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (31.46 KDa).