You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295622 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant AVPR1A. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 7B8 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | AVPR1A (NP_000697, 1 a.a. ~ 52 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAK |
NCBI | NP_000697 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In ascites fluid |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western Blot analysis of AVPR1A expression in transfected 293T cell line by AVPR1A monoclonal antibody (M07A), clone 7B8. Lane 1: AVPR1A transfected lysate(46.8 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (31.46 KDa).