ATX2/ATXN2 Antibody

• Catalog Number: orb308778
• Category: Antibodies
• Description: ATX2/ATXN2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ATX2 (1283-1313aa QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL), identical to the related mouse sequence.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, By Heat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 140283 MW
• UniProt ID: Q99700
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Ataxin-2;Spinocerebellar ataxia type 2 protein;Tri
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of ATX2/ATXN2 using anti-ATX2/ATXN2 antibody.Lane 1:human HeLa cell; 2:human K562 cell; 3:human A549 cell; 4:rat brain tissue; 5:mouse brain tissue; 6:mouse liver tissue.

IHC analysis of ATX2/ATXN2 using anti-ATX2/ATXN2 antibody. ATX2/ATXN2 was detected in a paraffin-embedded section of human breast cancer tissue.

IHC analysis of ATX2/ATXN2 using anti-ATX2/ATXN2 antibody. ATX2/ATXN2 was detected in a paraffin-embedded section of human colonic adenoma cancer tissue.

IHC analysis of ATX2/ATXN2 using anti-ATX2/ATXN2 antibody. ATX2/ATXN2 was detected in a paraffin-embedded section of human glioma tissue.

IHC analysis of ATX2/ATXN2 using anti-ATX2/ATXN2 antibody. ATX2/ATXN2 was detected in a paraffin-embedded section of human placenta tissue.