ATP6V1G2 monoclonal antibody (M02), clone 2E11

• Catalog Number: orb2295643
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ATP6V1G2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2E11
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2b Lambda
• Immunogen: ATP6V1G2 (NP_569730, 41 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: QMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA
• NCBI: NP_569730
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ATP6V1G2 monoclonal antibody (M02), clone 2E11 Western Blot analysis of ATP6V1G2 expression in HepG2.

ATP6V1G2 monoclonal antibody (M02), clone 2E11. Western Blot analysis of ATP6V1G2 expression in NIH/3T3.

ATP6V1G2 monoclonal antibody (M02), clone 2E11. Western Blot analysis of ATP6V1G2 expression in PC-12.

ATP6V1G2 monoclonal antibody (M02), clone 2E11. Western Blot analysis of ATP6V1G2 expression in Raw 264.7.

Western Blot analysis of ATP6V1G2 expression in transfected 293T cell line by ATP6V1G2 monoclonal antibody (M02), clone 2E11. Lane 1: ATP6V1G2 transfected lysate(13.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (34.32 KDa).