ATP6V1E1 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2295646
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human ATP6V1E1 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse
• Immunogen: ATP6V1E1 (NP_001687.1, 1 a.a. ~ 226 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
• NCBI: NP_001687.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ATP6V1E1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ATP6V1E1 expression in human kidney.

ATP6V1E1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ATP6V1E1 expression in Jurkat.

ATP6V1E1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ATP6V1E1 expression in mouse lung.

Western Blot analysis of ATP6V1E1 expression in transfected 293T cell line by ATP6V1E1 MaxPab polyclonal antibody. Lane 1: ATP6V1E1 transfected lysate(26.10 KDa). Lane 2: Non-transfected lysate.