ATP6V1E1 monoclonal antibody (M02), clone 4E11

• Catalog Number: orb2295645
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant ATP6V1E1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4E11
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: ATP6V1E1 (AAH04443, 1 a.a. ~ 226 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
• NCBI: AAH04443
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged ATP6V1E1 is 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ATP6V1E1 on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot analysis of ATP6V1E1 expression in transfected 293T cell line by ATP6V1E1 monoclonal antibody (M02), clone 4E11. Lane 1: ATP6V1E1 transfected lysate(26.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (50.6 KDa).