ATP6AP1 monoclonal antibody (M01), clone 3A2

• Catalog Number: orb2295638
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ATP6AP1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3A2
• Tested applications: ELISA, WB
• Reactivity: Human, Rat
• Isotype: IgG1 Kappa
• Immunogen: ATP6AP1 (NP_001174, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQE
• NCBI: NP_001174
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ATP6AP1 monoclonal antibody (M01), clone 3A2 Western Blot analysis of ATP6AP1 expression in HeLa.

ATP6AP1 monoclonal antibody (M01), clone 3A2. Western Blot analysis of ATP6AP1 expression in PC-12.

Detection limit for recombinant GST tagged ATP6AP1 is 0.1 ng/ml as a capture antibody.

Western Blot analysis of ATP6AP1 expression in transfected 293T cell line by ATP6AP1 monoclonal antibody (M01), clone 3A2. Lane 1: ATP6AP1 transfected lysate(52 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).