ATP6AP1 monoclonal antibody (M02), clone 3B11

• Catalog Number: orb2295637
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ATP6AP1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3B11
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: ATP6AP1 (NP_001174, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQE
• NCBI: NP_001174
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of ATP6AP1 expression in transfected 293T cell line by ATP6AP1 monoclonal antibody (M02), clone 3B11. Lane 1: ATP6AP1 transfected lysate (Predicted MW: 52 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).