You have no items in your shopping cart.
Cart summary
ATP5O Protein, Human, Recombinant (GST)
Catalog Number: orb1978945
| Catalog Number | orb1978945 |
|---|---|
| Category | Proteins |
| Description | ATP5O Protein, Human, Recombinant (GST) is expressed in E. coli. |
| Tag | N-GST |
| Purity | 98.00% |
| MW | 47.9 kDa (predicted) |
| UniProt ID | P48047 |
| Protein Sequence | FAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | ATP5O Protein, Human, Recombinant (GST) is expressed in E. coli. |
| Expression Region | 24-213 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
