ATP2C1 monoclonal antibody (M01), clone 2G1

• Catalog Number: orb2291246
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ATP2C1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 lambda
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ATP2C1 (AAH28139, 119 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: VQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQL
• Tested applications: ELISA, IF, IP, WB
• Clone Number: 2G1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH28139

ATP2C1 monoclonal antibody (M01), clone 2G1 Western Blot analysis of ATP2C1 expression in HeLa.

Detection limit for recombinant GST tagged ATP2C1 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ATP2C1 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoprecipitation of ATP2C1 transfected lysate using anti-ATP2C1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ATP2C1 MaxPab rabbit polyclonal antibody.

Western Blot analysis of ATP2C1 expression in transfected 293T cell line by ATP2C1 monoclonal antibody (M01), clone 2G1. Lane 1: ATP2C1 transfected lysate(100.6 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of ATP2C1 over-expressed 293 cell line, cotransfected with ATP2C1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ATP2C1 monoclonal antibody (M01), clone 2G1 (Cat # orb2291246). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (42.35 KDa).