You have no items in your shopping cart.
Cart summary
Item 1 of 1
ATP2B4 monoclonal antibody (M03A), clone 2C7
Catalog Number: orb2295675
| Catalog Number | orb2295675 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant ATP2B4. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 2C7 |
| Tested applications | ELISA, WB |
| Reactivity | Human |
| Isotype | IgG IgA IgM Mix Lambda |
| Immunogen | ATP2B4 (NP_001675, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKT |
| NCBI | NP_001675 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In ascites fluid |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Western Blot detection against Immunogen (35.86 KDa).
