ATP2A1 monoclonal antibody (M01), clone 1B11

• Catalog Number: orb2295688
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ATP2A1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B11
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: ATP2A1 (NP_775293, 522 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ
• NCBI: NP_775293
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ATP2A1 monoclonal antibody (M01), clone 1B11. Western Blot analysis of ATP2A1 expression in A-431.

Detection limit for recombinant GST tagged ATP2A1 is 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ATP2A1 on A-431 cell. [antibody concentration 10 ug/ml].

Immunoperoxidase of monoclonal antibody to ATP2A1 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml].

Western Blot analysis of ATP2A1 expression in transfected 293T cell line by ATP2A1 monoclonal antibody (M01), clone 1B11. Lane 1: ATP2A1 transfected lysate(109.3 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.75 KDa).