ATP1B3 purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2295695
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human ATP1B3 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: FC, WB
• Reactivity: Human
• Immunogen: ATP1B3 (NP_001670.1, 1 a.a. ~ 279 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
• NCBI: NP_001670.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ATP1B3 MaxPab polyclonal antibody. Western Blot analysis of ATP1B3 expression in A-431.

FACS analysis of negative control 293 cells (Black) and ATP1B3 expressing 293 cells (Green) using ATP1B3 purified MaxPab mouse polyclonal antibody.

Western Blot analysis of ATP1B3 expression in transfected 293T cell line by ATP1B3 MaxPab polyclonal antibody. Lane 1: ATP1B3 transfected lysate(30.69 KDa). Lane 2: Non-transfected lysate.