ATP1B3 MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2295694
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human ATP1B3 protein.
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Buffer/Preservatives: No additive
• Immunogen: ATP1B3 (NP_001670.1, 1 a.a. ~ 279 a.a) full-length human protein.
• Protein Sequence: MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
• Tested applications: IP, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001670.1

ATP1B3 MaxPab rabbit polyclonal antibody. Western Blot analysis of ATP1B3 expression in PC-12.

Immunoprecipitation of ATP1B3 transfected lysate using anti-ATP1B3 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ATP1B3 purified MaxPab mouse polyclonal antibody (B01P) (orb2295695).

Western Blot analysis of ATP1B3 expression in transfected 293T cell line by ATP1B3 MaxPab polyclonal antibody. Lane 1: ATP1B3 transfected lysate(31.5 KDa). Lane 2: Non-transfected lysate.