You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295694 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human ATP1B3 protein. |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Buffer/Preservatives | No additive |
Immunogen | ATP1B3 (NP_001670.1, 1 a.a. ~ 279 a.a) full-length human protein. |
Protein Sequence | MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA |
Tested applications | IP, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001670.1 |
ATP1B3 MaxPab rabbit polyclonal antibody. Western Blot analysis of ATP1B3 expression in PC-12.
Immunoprecipitation of ATP1B3 transfected lysate using anti-ATP1B3 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ATP1B3 purified MaxPab mouse polyclonal antibody (B01P) (orb2295695).
Western Blot analysis of ATP1B3 expression in transfected 293T cell line by ATP1B3 MaxPab polyclonal antibody. Lane 1: ATP1B3 transfected lysate(31.5 KDa). Lane 2: Non-transfected lysate.