ATP1A3 monoclonal antibody (M04A), clone 1D2

• Catalog Number: orb2295699
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ATP1A3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1D2
• Tested applications: ELISA
• Reactivity: Human
• Isotype: IgM Kappa
• Immunogen: ATP1A3 (NP_689509.1, 879 a.a. ~ 984 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: NWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPY
• NCBI: NP_689509.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.