You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295709 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ATOX1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3G11 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG |
Immunogen | ATOX1 (NP_004036, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE |
NCBI | NP_004036 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ATOX1 monoclonal antibody (M04), clone 3G11. Western Blot analysis of ATOX1 expression in COLO 320 HSR.
ATOX1 monoclonal antibody (M04), clone 3G11. Western Blot analysis of ATOX1 expression in HepG2.
ATOX1 monoclonal antibody (M04), clone 3G11. Western Blot analysis of ATOX1 expression in human kidney.
Detection limit for recombinant GST tagged ATOX1 is approximately 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.22 KDa).