You have no items in your shopping cart.
Cart summary
Item 1 of 6
Item 1 of 6
ATOX1 monoclonal antibody (M01), clone 2E6
Catalog Number: orb2295713
| Catalog Number | orb2295713 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant ATOX1. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 2E6 |
| Tested applications | ELISA, IF, WB |
| Reactivity | Human |
| Isotype | IgG2a Kappa |
| Immunogen | ATOX1 (NP_004036, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE |
| NCBI | NP_004036 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
ATOX1 monoclonal antibody (M01), clone 2E6 Western Blot analysis of ATOX1 expression in Hela S3 NE.
ATOX1 monoclonal antibody (M01), clone 2E6. Western Blot analysis of ATOX1 expression in COLO 320 HSR.
ATOX1 monoclonal antibody (M01), clone 2E6. Western Blot analysis of ATOX1 expression in human liver.
Detection limit for recombinant GST tagged ATOX1 is approximately 0.3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to ATOX1 on HeLa cell. [antibody concentration 10 ug/ml].
Western Blot detection against Immunogen (33.22 KDa).
