You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291714 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ATG5. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1G11 |
Tested applications | ELISA, WB |
Reactivity | Human, Mouse |
Isotype | IgG2a Kappa |
Immunogen | ATG5 (AAH02699, 176 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | PAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD |
NCBI | AAH02699 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ATG5 monoclonal antibody (M04), clone 1G11. Western Blot analysis of ATG5 expression in Jurkat.
ATG5 monoclonal antibody (M04), clone 1G11. Western Blot analysis of ATG5 expression in NIH/3T3.
ATG5 monoclonal antibody (M04), clone 1G11. Western Blot analysis of ATG5 expression in Raw 264.7.
Western Blot detection against Immunogen (36.63 KDa).