ATG4B Rabbit Polyclonal Antibody

• Catalog Number: orb583751
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATG4B
• Target: ATG4B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATG4B
• Protein Sequence: Synthetic peptide located within the following region: WGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDS
• UniProt ID: Q9Y4P1
• MW: 44kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: APG4B, AUTL1
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_037457

Rabbit Anti-ATG4B Antibody, Catalog Number: orb583751, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-ATG4B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Placenta.

WB Suggested Anti-ATG4B antibody Titration: 1 ug/ml, Sample Type: Human heart.