ATG14L Antibody

• Catalog Number: orb308776
• Category: Antibodies
• Description: ATG14L Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L (70-101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME), different from the related mouse and rat sequences by two amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Rat, By HeatWestern blot, 0.1-0.5μg/ml, Human, RatImmunohistochemistry (Frozen Section), 0.5-1μg/ml, Human Immunocytochemistry, 0.5-1μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 55309 MW
• UniProt ID: Q6ZNE5
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Beclin 1-associated autophagy-related key regulato
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of SiHa cells using anti-ATG14L antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of A431 cells using anti-ATG14L antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of PC-3 cells using anti-ATG14L antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of ATG14L using anti-ATG14L antibody.Lane 1:Rat Brain Tissue;2:HELA Cell.

IF analysis of ATG14L using anti-ATG14L antibody. ATG14L was detected in an immunocytochemical section of U2OS cells.

IF analysis of ATG14L using anti-ATG14L antibody. ATG14L was detected in a paraffin-embedded section of human lung cancer tissue.

IF analysis of ATG14L using anti-ATG14L antibody. ATG14L was detected in a paraffin-embedded section of human colon cancer tissue.

IF analysis of ATG14L using anti-ATG14L antibody. ATG14L was detected in a paraffin-embedded section of rat spleen tissue.

IHC analysis of ATG14L using anti-ATG14L antibody.ATG14L was detected in paraffin-embedded section of Rat Spleen Tissue.

IHC analysis of ATG14L using anti-ATG14L antibody.ATG14L was detected in paraffin-embedded section of Human Lung Cancer Tissue.