You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb443095 |
---|---|
Category | Antibodies |
Description | ATF4 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human ATF4 (KELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 50 kDa |
UniProt ID | P18848 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Cyclic AMP-dependent transcription factor ATF-4; c Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of ATF4 using anti-ATF4 antibody.Lane 1:human SW620 cell;2:human HeLa cell.
IHC analysis of ATF4 using anti-ATF4 antibody.ATF4 was detected in paraffin-embedded section of human ovary cancer tissue.
IHC analysis of ATF4 using anti-ATF4 antibody.ATF4 was detected in paraffin-embedded section of human prostatic cancer tissue.
ICC, IF, IHC-P, WB | |
Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating