You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295743 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant ATF3. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 8G5 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG3 Kappa |
Immunogen | ATF3 (AAH06322, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS |
NCBI | AAH06322 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ATF3 monoclonal antibody (M04), clone 8G5 Western Blot analysis of ATF3 expression in Hela S3 NE.
Detection limit for recombinant GST tagged ATF3 is approximately 1 ng/ml as a capture antibody.
Western Blot analysis of ATF3 expression in transfected 293T cell line by ATF3 monoclonal antibody (M04), clone 8G5. Lane 1: ATF3 transfected lysate(20.6 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (45.65 KDa).