ATF3 monoclonal antibody (M01), clone 6B8

• Catalog Number: orb2295745
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant ATF3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6B8
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG3 Kappa
• Immunogen: ATF3 (AAH06322, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
• NCBI: AAH06322
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged ATF3 is approximately 1 ng/ml as a capture antibody.

Western Blot analysis of ATF3 expression in transfected 293T cell line by ATF3 monoclonal antibody (M01), clone 6B8. Lane 1: ATF3 transfected lysate(20.6 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of ATF3 over-expressed 293 cell line, cotransfected with ATF3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ATF3 monoclonal antibody (M01), clone 6B8 (Cat # orb2295745). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (45.65 KDa).