You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2054301 |
---|---|
Category | Proteins |
Description | ASPH Recombinant Protein (Human) |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 38.2 kDa |
UniProt ID | Q12797 |
Protein Sequence | FDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT |
Source | E.coli |
NCBI | NP_001158222 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | A beta H-J-J;AAH;ASP beta-hydroxylase;Aspartate be Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
38.2 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
38.2 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
38.2 kDa | |
E.coli |
98.00% | |
The protein has a predicted MW of 49.2 kDa same as Tris-Bis PAGE result. |
Filter by Rating