ASPH MaxPab rabbit polyclonal antibody (D03)

• Catalog Number: orb2295763
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human ASPH protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Reactivity: Human
• Immunogen: ASPH (NP_115856.1, 1 a.a. ~ 210 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEELKKEKEKPESRKESKNEERKKGKKEDVRKDKKIADADLSRKESPKGKKDREKEKVDLEKSAKTKENRKKSTNMKDVSSKMASRDKDDRKESRSSTRYAHLTKGNTQKRNG
• NCBI: NP_115856.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: No additive
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoprecipitation of ASPH transfected lysate using anti-ASPH MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ASPH purified MaxPab mouse polyclonal antibody (B02P) (orb2295765).

Western Blot analysis of ASPH expression in transfected 293T cell line by ASPH MaxPab polyclonal antibody. Lane 1: ASPH transfected lysate(23.8 KDa). Lane 2: Non-transfected lysate.