Cart summary

You have no items in your shopping cart.

ASIC2 Peptide - C-terminal region

ASIC2 Peptide - C-terminal region

Catalog Number: orb2000719

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2000719
CategoryProteins
DescriptionASIC2 Peptide - C-terminal region
Tested applicationsWB
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW56 kDa
UniProt IDQ16515
Protein SequenceSynthetic peptide located within the following region: GASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENVSTCDTMPNHSE
NCBINP_001085.2
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesACCN, BNC1, MDEG, ACCN1, BNaC1, ASIC2a, hBNaC1
Read more...
NoteFor research use only
Application notesThis is a synthetic peptide designed for use in combination with ASIC2 Rabbit Polyclonal Antibody (orb589245). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Expiration Date6 months from date of receipt.