ASCL1 monoclonal antibody (M01), clone 7E11

• Catalog Number: orb2295792
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ASCL1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ASCL1 (NP_004307, 137 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
• Tested applications: ELISA, WB
• Clone Number: 7E11
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004307

Detection limit for recombinant GST tagged ASCL1 is approximately 1 ng/ml as a capture antibody.

Western Blot analysis of ASCL1 expression in transfected 293T cell line by ASCL1 monoclonal antibody (M01), clone 7E11. Lane 1: ASCL1 transfected lysate(25.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).