ART3 monoclonal antibody (M09), clone 1D2

• Catalog Number: orb2295804
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ART3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1D2
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: ART3 (NP_001170, 29 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LDMADNAFDDEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAF
• NCBI: NP_001170
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoprecipitation of ART3 transfected lysate using anti-ART3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ART3 MaxPab rabbit polyclonal antibody.

Western Blot analysis of ART3 expression in transfected 293T cell line by ART3 monoclonal antibody (M09), clone 1D2. Lane 1: ART3 transfected lysate(42.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).