ARSB monoclonal antibody (M10), clone 2G6

• Catalog Number: orb2295815
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ARSB.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ARSB (NP_942002, 166 a.a. ~ 265 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: FGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHH
• Tested applications: ELISA, WB
• Clone Number: 2G6
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_942002

Detection limit for recombinant GST tagged ARSB is 1 ng/ml as a capture antibody.

Western Blot detection against Immunogen (36.74 KDa).