ARRB2 monoclonal antibody (M06), clone 4D2

• Catalog Number: orb2295822
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ARRB2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ARRB2 (AAH07427, 300 a.a. ~ 409 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC
• Tested applications: ELISA, IF, WB
• Clone Number: 4D2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH07427

ARRB2 monoclonal antibody (M06), clone 4D2. Western Blot analysis of ARRB2 expression in MCF-7.

ARRB2 monoclonal antibody (M06), clone 4D2. Western Blot analysis of ARRB2 expression in PC-12.

Detection limit for recombinant GST tagged ARRB2 is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ARRB2 on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot detection against Immunogen (37.84 KDa).