You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295822 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ARRB2. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | ARRB2 (AAH07427, 300 a.a. ~ 409 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC |
Tested applications | ELISA, IF, WB |
Clone Number | 4D2 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH07427 |
ARRB2 monoclonal antibody (M06), clone 4D2. Western Blot analysis of ARRB2 expression in MCF-7.
ARRB2 monoclonal antibody (M06), clone 4D2. Western Blot analysis of ARRB2 expression in PC-12.
Detection limit for recombinant GST tagged ARRB2 is approximately 0.3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to ARRB2 on HeLa cell. [antibody concentration 10 ug/ml].
Western Blot detection against Immunogen (37.84 KDa).