ARRB2 monoclonal antibody (M01), clone 3G1

• Catalog Number: orb2295823
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ARRB2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ARRB2 (AAH07427, 300 a.a. ~ 409 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC
• Tested applications: ELISA, IF, PLA, WB
• Clone Number: 3G1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH07427

Detection limit for recombinant GST tagged ARRB2 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ARRB2 on HeLa cell. [antibody concentration 10 ug/ml].

Proximity Ligation Analysis of protein-protein interactions between MAPK3 and ARRB2. HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-ARRB2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of ARRB2 expression in transfected 293T cell line by ARRB2 monoclonal antibody (M01), clone 3G1. Lane 1: ARRB2 transfected lysate(46 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).