ARNT monoclonal antibody (M01), clone 3D10

• Catalog Number: orb2295831
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ARNT.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ARNT (AAH60838, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 3D10
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH60838
• Expiration Date: 12 months from date of receipt.

ARNT monoclonal antibody (M01), clone 3D10 Western Blot analysis of ARNT expression in Hela S3 NE.

Detection limit for recombinant GST tagged ARNT is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ARNT on HeLa cell. [antibody concentration 10 ug/ml].

Immunoperoxidase of monoclonal antibody to ARNT on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml].

Western Blot analysis of ARNT expression in transfected 293T cell line by ARNT monoclonal antibody (M01), clone 3D10. Lane 1: ARNT transfected lysate(86.6 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of ARNT over-expressed 293 cell line, cotransfected with ARNT Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARNT monoclonal antibody (M01), clone 3D10 (Cat # orb2295831). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (37.73 KDa).