You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295831 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ARNT. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | ARNT (AAH60838, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT |
Tested applications | ELISA, IF, IHC-P, WB |
Clone Number | 3D10 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH60838 |
Expiration Date | 12 months from date of receipt. |
ARNT monoclonal antibody (M01), clone 3D10 Western Blot analysis of ARNT expression in Hela S3 NE.
Detection limit for recombinant GST tagged ARNT is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to ARNT on HeLa cell. [antibody concentration 10 ug/ml].
Immunoperoxidase of monoclonal antibody to ARNT on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml].
Western Blot analysis of ARNT expression in transfected 293T cell line by ARNT monoclonal antibody (M01), clone 3D10. Lane 1: ARNT transfected lysate(86.6 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of ARNT over-expressed 293 cell line, cotransfected with ARNT Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARNT monoclonal antibody (M01), clone 3D10 (Cat # orb2295831). GAPDH (36.1 kDa) used as specificity and loading control.
Western Blot detection against Immunogen (37.73 KDa).