ARL8B Rabbit Polyclonal Antibody

• Catalog Number: orb583457
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ARL8B
• Target: ARL8B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARL8B
• Protein Sequence: Synthetic peptide located within the following region: SRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDRE
• UniProt ID: Q9NVJ2
• MW: 22 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Gie1, ARL10C
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_060654

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment.

Positive control (+): THP1 cell lysate (N30), Negative control (-): A549 cell lysate (N03), Antibody concentration: 5 ug/ml.

WB Suggested Anti-ARL8B Antibody Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.