ARL6IP4 monoclonal antibody (M09), clone 5E5

• Catalog Number: orb2291143
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ARL6IP4.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ARL6IP4 (NP_061164, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: PGPSLDQWHRSAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 5E5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_061164

ARL6IP4 monoclonal antibody (M09), clone 5E5 Western Blot analysis of ARL6IP4 expression in Hela S3 NE.

Detection limit for recombinant GST tagged ARL6IP4 is 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ARL6IP4 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to ARL6IP4 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (36.74 KDa).